Turbohost Logo
  • Free SSL
  • Human support
  • Free migration
  • Free domain

Domain, hosting, and email in one TurboHost account

Find a domain, pick a plan, and put your site online. LiteSpeed hosting, prices in your currency, and a team available by phone or ticket.

From Ksh 194.17/year

99.9 %

uptime: your site stays online

30 days

money-back on hosting plans

0 KES

site migration by our team

+3000 customers

who already trust TurboHost

Products

Choose what you need

Domain, hosting, email and VPS. Pick where to start and get your business online.

Pay in KES, however you prefermpesamastercardvisapaypal
How it works

Online in 3 steps

From domain to published site, no technical skills needed.

Search for your domain

Type your business name and see right away if .co.ke is available.

Pick a plan

Hosting with email and SSL included. Pay in KES, with local methods or card.

Publish the site

Use the no-code builder or install WordPress in one click. You're live.

Search domainNeed help? Our team supports you by phone or ticket.
Web Hosting

Your site online: fast and stable

Host sites and online stores on LiteSpeed servers with CloudLinux. Manage everything in a simple DirectAdmin panel without getting lost in menus.

  • LiteSpeed + CloudLinux for faster page loads
  • Email, SSL, and free migration included
  • 99.9% uptime target, monitored 24/7

From Ksh 1,158.58/mo

Website Builder

Build a site without writing code

Pick a template, swap text and images, and publish in minutes. No design experience and no agency required.

  • Dozens of ready-to-use templates
  • Visual editor with AI assistance
  • Publish on your domain in one click

Included with hosting plans

Professional Email

Email on your own domain

Send from [email protected] instead of a generic address. More trust for customers, independent of your hosting plan.

  • Unlimited mailboxes
  • Antispam and webmail included
  • Set up on phone and Outlook
Domains

Your domain in one account

Register, transfer, and renew domains alongside your hosting plans. Local and international TLDs, managed in the same place.

  • Local ccTLDs and international extensions
  • Transfer domains from other providers
  • Domain, hosting, and email on one invoice

From Ksh 194.17/year

VPS Servers

Resources all yours, with KVM virtualization

When a shared plan is no longer enough, a VPS gives you dedicated CPU, RAM, and NVMe disk, with root access and your own IP to scale freely.

  • Dedicated vCPU, RAM, and NVMe
  • Dedicated IPv4 and KVM virtualization
  • Guaranteed 100 Mbps port

From Ksh 1,448.54/mo

Free migration

With another provider? We move everything for you

Our team transfers your site, emails, and domains at no cost and with no downtime. You don't touch a thing. We handle it all.

  • Site and emails moved by specialists
  • No interruption: your site stays online
  • 0 KES, on any hosting plan
Testimonials

What clients say.

Fast answers from a team that works on servers every day, not a script.

FAQ

Still have questions?

How can I pay?

Yes. You pay online in your local currency with the methods available for your country. Your invoice appears instantly in the client area.

How does free migration work?

Open a ticket with access details for your current provider and our team transfers the site, emails, and databases at no cost. The site stays online throughout the process.

Is the domain really free?

On eligible hosting plans, first-year domain registration is included. Covered extensions and renewal terms are listed on each plan page.

Do I need technical skills to get started?

No. The panel is simple and the website builder needs no code. If you need help, our team assists by phone or ticket. A team that knows hosting, not a chatbot.

How does the 30-day guarantee work?

Try risk-free: if in the first 30 days the hosting plan isn’t what you needed, we refund you. No complicated questions.

Can I change plans later?

Yes, upgrade anytime from a shared plan to a larger one or to a VPS, without losing data or settings.

Didn't find the answer? Browse the knowledge base or open a ticket.

Ready to get your website up?

Pick your domain, pick your plan. We handle the rest.